PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID NNU_005293-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; stem eudicotyledons; Proteales; Nelumbonaceae; Nelumbo
Family WRKY
Protein Properties Length: 743aa    MW: 80234.5 Da    PI: 5.7825
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
NNU_005293-RAgenomeCASView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY102.42.5e-32325382260
                    --SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS-- CS
           WRKY   2 dDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhek 60 
                    +DgynWrKYGqK+vkgsefprsYY+Ct+++C+vkkkvers  +++++ei+Y+g Hnh+k
  NNU_005293-RA 325 EDGYNWRKYGQKQVKGSEFPRSYYKCTHPHCQVKKKVERSP-EGHITEIIYKGAHNHPK 382
                    7****************************************.***************85 PP

2WRKY102.81.9e-32537595159
                    ---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
           WRKY   1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                    ldDgy+WrKYGqK+vkg+++prsYY+Ct agC+v+k+ver+a+d k v++tYeg+Hnh+
  NNU_005293-RA 537 LDDGYRWRKYGQKVVKGNPNPRSYYKCTNAGCTVRKHVERAAHDLKSVITTYEGKHNHD 595
                    59********************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.20.25.804.0E-28322383IPR003657WRKY domain
SuperFamilySSF1182903.79E-25323383IPR003657WRKY domain
SMARTSM007746.0E-35324382IPR003657WRKY domain
PfamPF031061.6E-24325381IPR003657WRKY domain
PROSITE profilePS5081122.355325383IPR003657WRKY domain
Gene3DG3DSA:2.20.25.801.1E-36522597IPR003657WRKY domain
SuperFamilySSF1182901.96E-28529597IPR003657WRKY domain
PROSITE profilePS5081138.067532597IPR003657WRKY domain
SMARTSM007742.0E-37537596IPR003657WRKY domain
PfamPF031068.1E-25538595IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009555Biological Processpollen development
GO:0009942Biological Processlongitudinal axis specification
GO:0030010Biological Processestablishment of cell polarity
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 743 aa     Download sequence    Send to blast
MAGIDDNVAV IGDWAPPEPS PRTFFSTILG DDFGSRPFSE LLEHNGNGGS LPNSSQGTHA  60
GADQKDMASS EDKNGTGVDA STHLLSEPSL FSIQKSSSRG GLAERMAARA GFSAPKLNTE  120
KIRSANLSSS PEIQSPYITI PPGLSPTTLL DSPVFLSNSL AQPSPTTGKF SFASSSNSRS  180
SLSISEAPER SKDGTFEDVD TSSFEFKPHL KSSSLFFADA NKVTSVSNLQ QSFPRIEVSV  240
QSGKSLMSQN AEQTDVLSQN QNGFNQPEFP KASIGRDREG KNIVPDPVVF DTVAGNAECS  300
PPLEEQHDGE EEKREVNSIG GAPSEDGYNW RKYGQKQVKG SEFPRSYYKC THPHCQVKKK  360
VERSPEGHIT EIIYKGAHNH PKPPPNRRSA IGSSNLSDMH LDIPEQAGLQ DGAVGDAAWA  420
SSQPVSIIGG PEWRCDNLEV TSAMSPDFCD PSNSQAQNGL HLESGDAVDV SSTLSNDEDE  480
DDRGTHGSMS LGYDGEGDES ESKRRRIDAS VLEMNGASRA IREPRVVVQT TSEVDILDDG  540
YRWRKYGQKV VKGNPNPRSY YKCTNAGCTV RKHVERAAHD LKSVITTYEG KHNHDVPAAR  600
NSNHVSSSNS ITAPLPTSQT QVHRPEPSQI HNSMARFEGP ASISSFSLPG RQQVGPSTGF  660
TFAMTQPGLA NLAMAGLGPS ERKLPVLPVH PYLGQQRQLS EMGFMIPKGE PKEETMPEPG  720
LNLSNGSSVY HQIMNRLPLG PPL
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wj2_A1e-34325598878Probable WRKY transcription factor 4
2lex_A1e-34325598878Probable WRKY transcription factor 4
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1502506KRRRI
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00071PBMTransfer from AT5G56270Download
Motif logo
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010252876.10.0PREDICTED: probable WRKY transcription factor 2
RefseqXP_010252877.10.0PREDICTED: probable WRKY transcription factor 2
TrEMBLF6I4X40.0F6I4X4_VITVI; Putative uncharacterized protein
STRINGVIT_19s0015g01870.t010.0(Vitis vinifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G56270.11e-180WRKY DNA-binding protein 2